PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca20822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 343aa    MW: 38657.1 Da    PI: 9.5446
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca20822.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM92.47.5e-2957953128
         NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++++ew+fFs+r kky++g++++rat+ gyWkatgk+++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Dca20822.1   5 SSDQEWFFFSPRGKKYPNGSQSKRATEIGYWKATGKERAVKS-GSNVIGTKRTLVFHIGRAPKGERTEWIMHEYCM 79 
                 4689*************************************9.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100535.909195IPR003441NAC domain
SuperFamilySSF1019418.76E-33595IPR003441NAC domain
PfamPF023652.1E-13978IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
KSIISSDQEW FFFSPRGKKY PNGSQSKRAT EIGYWKATGK ERAVKSGSNV IGTKRTLVFH  60
IGRAPKGERT EWIMHEYCMI GKGQDALVVC RLRRKCDYHA IDEPSSEILL PNNSLTMMGS  120
SGTNSGCLEP ASTTPGYKTA ESSLKKSSSS HDSHSIEQMD SASQSDWKFK DEILQPESSS  180
HAKRCNDEDD LFAEILNDNI VQLDECPPTS RDDASPIVDT TTTTTTTVSI VPRQNRQPNH  240
PHMMQSYPSQ GTANRRIRLR KLRRVSPRKE EIEEHMGQNV IANPKLGRFW RVSILRGPMR  300
LRVDGNRVFV LIVVMSLLIL FISYIVTTPM LFLAMRIPPS LGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-2549570168NAC domain-containing protein 19
3swp_C2e-2549570168NAC domain-containing protein 19
3swp_B2e-2549570168NAC domain-containing protein 19
3swp_A2e-2549570168NAC domain-containing protein 19
3swm_D2e-2549570168NAC domain-containing protein 19
3swm_C2e-2549570168NAC domain-containing protein 19
3swm_B2e-2549570168NAC domain-containing protein 19
3swm_A2e-2549570168NAC domain-containing protein 19
4dul_B2e-2549567165NAC domain-containing protein 19
4dul_A2e-2549567165NAC domain-containing protein 19
1ut7_B2e-2549567165NO APICAL MERISTEM PROTEIN
1ut7_A2e-2549567165NO APICAL MERISTEM PROTEIN
1ut4_B2e-2549567165NO APICAL MERISTEM PROTEIN
1ut4_A2e-2549567165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254260RRIRLRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692710.11e-111PREDICTED: NAC domain-containing protein 89-like isoform X1
TrEMBLA0A0K9RGM41e-115A0A0K9RGM4_SPIOL; Uncharacterized protein
TrEMBLA0A0K9RI701e-114A0A0K9RI70_SPIOL; Uncharacterized protein
STRINGVIT_06s0080g00970.t015e-76(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.19e-57NAC domain containing protein 60